Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,826
  2. Avatar for Go Science 2. Go Science 71 pts. 11,778
  3. Avatar for VeFold 3. VeFold 49 pts. 11,742
  4. Avatar for Contenders 4. Contenders 33 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,683
  6. Avatar for Australia 6. Australia 14 pts. 11,639
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,625
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,543
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 11,471
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,460
  1. Avatar for sato 71. sato Lv 1 1 pt. 10,796
  2. Avatar for Swapper242 72. Swapper242 Lv 1 1 pt. 10,789
  3. Avatar for zo3xiaJonWeinberg 73. zo3xiaJonWeinberg Lv 1 1 pt. 10,785
  4. Avatar for Matrena 74. Matrena Lv 1 1 pt. 10,776
  5. Avatar for Hellcat6 75. Hellcat6 Lv 1 1 pt. 10,627
  6. Avatar for DipsyDoodle2016 76. DipsyDoodle2016 Lv 1 1 pt. 9,985
  7. Avatar for salbei 77. salbei Lv 1 1 pt. 9,873
  8. Avatar for kushiro189 78. kushiro189 Lv 1 1 pt. 7,757
  9. Avatar for HNOF 79. HNOF Lv 1 1 pt. 7,742
  10. Avatar for toshiue 80. toshiue Lv 1 1 pt. 7,731

Comments