Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,826
  2. Avatar for Go Science 2. Go Science 71 pts. 11,778
  3. Avatar for VeFold 3. VeFold 49 pts. 11,742
  4. Avatar for Contenders 4. Contenders 33 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,683
  6. Avatar for Australia 6. Australia 14 pts. 11,639
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,625
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,543
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 11,471
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,460
  1. Avatar for majyunyan 31. majyunyan Lv 1 10 pts. 11,530
  2. Avatar for Fasodankfds 32. Fasodankfds Lv 1 9 pts. 11,527
  3. Avatar for silent gene 33. silent gene Lv 1 8 pts. 11,521
  4. Avatar for jtrube1 34. jtrube1 Lv 1 7 pts. 11,501
  5. Avatar for Joanna_H 35. Joanna_H Lv 1 6 pts. 11,471
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 6 pts. 11,469
  7. Avatar for jausmh 37. jausmh Lv 1 5 pts. 11,460
  8. Avatar for latin krepin 38. latin krepin Lv 1 5 pts. 11,438
  9. Avatar for SemperRabbit 39. SemperRabbit Lv 1 4 pts. 11,382
  10. Avatar for carsonfb 40. carsonfb Lv 1 4 pts. 11,381

Comments