Placeholder image of a protein
Icon representing a puzzle

2708: Electron Density Reconstruction 151

Closed since 2 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 55,083
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 54,528
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 52,544
  4. Avatar for CBE_ProEn_2025 14. CBE_ProEn_2025 1 pt. 46,520
  1. Avatar for majyunyan 21. majyunyan Lv 1 20 pts. 56,231
  2. Avatar for spvincent 22. spvincent Lv 1 18 pts. 56,227
  3. Avatar for BarrySampson 23. BarrySampson Lv 1 16 pts. 56,210
  4. Avatar for TheGUmmer 24. TheGUmmer Lv 1 15 pts. 56,206
  5. Avatar for SemperRabbit 25. SemperRabbit Lv 1 13 pts. 56,196
  6. Avatar for silent gene 26. silent gene Lv 1 12 pts. 56,155
  7. Avatar for jausmh 27. jausmh Lv 1 11 pts. 56,145
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 10 pts. 56,074
  9. Avatar for BootsMcGraw 29. BootsMcGraw Lv 1 9 pts. 56,059
  10. Avatar for Wanderer09 30. Wanderer09 Lv 1 8 pts. 56,057

Comments