Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 2 months ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,384
  2. Avatar for Team China 12. Team China 1 pt. 9,793
  1. Avatar for Dr. Goochie 11. Dr. Goochie Lv 1 48 pts. 10,795
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 45 pts. 10,785
  3. Avatar for Galaxie 13. Galaxie Lv 1 41 pts. 10,773
  4. Avatar for gmn 14. gmn Lv 1 38 pts. 10,769
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 35 pts. 10,765
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 32 pts. 10,717
  7. Avatar for Aarav_Awasthi 17. Aarav_Awasthi Lv 1 30 pts. 10,716
  8. Avatar for Elfi 18. Elfi Lv 1 27 pts. 10,708
  9. Avatar for jausmh 19. jausmh Lv 1 25 pts. 10,695
  10. Avatar for drjr 20. drjr Lv 1 23 pts. 10,684

Comments