Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390
  1. Avatar for Dr. Goochie 11. Dr. Goochie Lv 1 48 pts. 10,795
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 45 pts. 10,785
  3. Avatar for Galaxie 13. Galaxie Lv 1 41 pts. 10,773
  4. Avatar for gmn 14. gmn Lv 1 38 pts. 10,769
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 35 pts. 10,765
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 32 pts. 10,717
  7. Avatar for Aarav_Awasthi 17. Aarav_Awasthi Lv 1 30 pts. 10,716
  8. Avatar for Elfi 18. Elfi Lv 1 27 pts. 10,708
  9. Avatar for jausmh 19. jausmh Lv 1 25 pts. 10,695
  10. Avatar for drjr 20. drjr Lv 1 23 pts. 10,684

Comments