Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,384
  2. Avatar for Team China 12. Team China 1 pt. 9,793
  1. Avatar for Guiguitare 31. Guiguitare Lv 1 8 pts. 10,530
  2. Avatar for vybi 32. vybi Lv 1 7 pts. 10,523
  3. Avatar for g_b 33. g_b Lv 1 6 pts. 10,505
  4. Avatar for AlphaFold2 34. AlphaFold2 Lv 1 5 pts. 10,460
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 5 pts. 10,456
  6. Avatar for heather-1 36. heather-1 Lv 1 4 pts. 10,443
  7. Avatar for zxspectrum 37. zxspectrum Lv 1 4 pts. 10,398
  8. Avatar for Joanna_H 38. Joanna_H Lv 1 3 pts. 10,390
  9. Avatar for aendgraend 39. aendgraend Lv 1 3 pts. 10,384
  10. Avatar for Th1sN@me!sN0tAPun 40. Th1sN@me!sN0tAPun Lv 1 3 pts. 10,378

Comments