Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since 4 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390

  1. Avatar for Guiguitare 31. Guiguitare Lv 1 8 pts. 10,530
  2. Avatar for vybi 32. vybi Lv 1 7 pts. 10,523
  3. Avatar for g_b 33. g_b Lv 1 6 pts. 10,505
  4. Avatar for AlphaFold2 34. AlphaFold2 Lv 1 5 pts. 10,460
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 5 pts. 10,456
  6. Avatar for heather-1 36. heather-1 Lv 1 4 pts. 10,443
  7. Avatar for zxspectrum 37. zxspectrum Lv 1 4 pts. 10,398
  8. Avatar for Joanna_H 38. Joanna_H Lv 1 3 pts. 10,390
  9. Avatar for aendgraend 39. aendgraend Lv 1 3 pts. 10,384
  10. Avatar for Th1sN@me!sN0tAPun 40. Th1sN@me!sN0tAPun Lv 1 3 pts. 10,378

Comments