Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 2 months ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,384
  2. Avatar for Team China 12. Team China 1 pt. 9,793
  1. Avatar for hada 51. hada Lv 1 1 pt. 10,111
  2. Avatar for p.naka 52. p.naka Lv 1 1 pt. 10,061
  3. Avatar for Ghost103 53. Ghost103 Lv 1 1 pt. 10,025
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 10,016
  5. Avatar for TryinToHelp 55. TryinToHelp Lv 1 1 pt. 9,996
  6. Avatar for ZiiONIC 56. ZiiONIC Lv 1 1 pt. 9,970
  7. Avatar for Trajan464 57. Trajan464 Lv 1 1 pt. 9,960
  8. Avatar for toshiue 58. toshiue Lv 1 1 pt. 9,928
  9. Avatar for Negrilo 59. Negrilo Lv 1 1 pt. 9,902
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 9,890

Comments