Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390
  1. Avatar for hada 51. hada Lv 1 1 pt. 10,111
  2. Avatar for p.naka 52. p.naka Lv 1 1 pt. 10,061
  3. Avatar for Ghost103 53. Ghost103 Lv 1 1 pt. 10,025
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 10,016
  5. Avatar for TryinToHelp 55. TryinToHelp Lv 1 1 pt. 9,996
  6. Avatar for ZiiONIC 56. ZiiONIC Lv 1 1 pt. 9,970
  7. Avatar for Trajan464 57. Trajan464 Lv 1 1 pt. 9,960
  8. Avatar for toshiue 58. toshiue Lv 1 1 pt. 9,928
  9. Avatar for Negrilo 59. Negrilo Lv 1 1 pt. 9,902
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 9,890

Comments