Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,384
  2. Avatar for Team China 12. Team China 1 pt. 9,793
  1. Avatar for DScott 61. DScott Lv 1 1 pt. 9,878
  2. Avatar for ditto 62. ditto Lv 1 1 pt. 9,869
  3. Avatar for c1K 63. c1K Lv 1 1 pt. 9,856
  4. Avatar for zbp 64. zbp Lv 1 1 pt. 9,842
  5. Avatar for Jimmalas 65. Jimmalas Lv 1 1 pt. 9,802
  6. Avatar for zo3xiaJonWeinberg 66. zo3xiaJonWeinberg Lv 1 1 pt. 9,793
  7. Avatar for Lera 67. Lera Lv 1 1 pt. 9,766
  8. Avatar for RWoodcock 68. RWoodcock Lv 1 1 pt. 9,569
  9. Avatar for Stas Gunko 69. Stas Gunko Lv 1 1 pt. 9,497
  10. Avatar for Idiotboy 70. Idiotboy Lv 1 1 pt. 3,796

Comments