Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390
  1. Avatar for DScott 61. DScott Lv 1 1 pt. 9,878
  2. Avatar for ditto 62. ditto Lv 1 1 pt. 9,869
  3. Avatar for c1K 63. c1K Lv 1 1 pt. 9,856
  4. Avatar for zbp 64. zbp Lv 1 1 pt. 9,842
  5. Avatar for Jimmalas 65. Jimmalas Lv 1 1 pt. 9,802
  6. Avatar for zo3xiaJonWeinberg 66. zo3xiaJonWeinberg Lv 1 1 pt. 9,793
  7. Avatar for Lera 67. Lera Lv 1 1 pt. 9,766
  8. Avatar for RWoodcock 68. RWoodcock Lv 1 1 pt. 9,569
  9. Avatar for Stas Gunko 69. Stas Gunko Lv 1 1 pt. 9,497
  10. Avatar for Idiotboy 70. Idiotboy Lv 1 1 pt. 3,796

Comments