Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary


Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups


  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 23,539

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 47 pts. 25,756
  2. Avatar for spvincent 12. spvincent Lv 1 43 pts. 25,706
  3. Avatar for g_b 13. g_b Lv 1 40 pts. 25,699
  4. Avatar for gmn 14. gmn Lv 1 36 pts. 25,685
  5. Avatar for nicobul 15. nicobul Lv 1 33 pts. 25,673
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 30 pts. 25,670
  7. Avatar for Xendrais 17. Xendrais Lv 1 28 pts. 25,670
  8. Avatar for westchuck 18. westchuck Lv 1 25 pts. 25,661
  9. Avatar for Elfi 19. Elfi Lv 1 23 pts. 25,643
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 21 pts. 25,641

Comments