Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary

Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 37,389
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 35,226
  1. Avatar for NinjaGreg 31. NinjaGreg Lv 1 5 pts. 37,955
  2. Avatar for Pazithi 32. Pazithi Lv 1 4 pts. 37,901
  3. Avatar for Trajan464 33. Trajan464 Lv 1 4 pts. 37,801
  4. Avatar for stomjoh 34. stomjoh Lv 1 3 pts. 37,710
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 3 pts. 37,637
  6. Avatar for toshiue 36. toshiue Lv 1 2 pts. 37,567
  7. Avatar for AlphaFold2 37. AlphaFold2 Lv 1 2 pts. 37,554
  8. Avatar for vybi 38. vybi Lv 1 2 pts. 37,496
  9. Avatar for kitek314_pl 39. kitek314_pl Lv 1 2 pts. 37,389
  10. Avatar for Crossed Sticks 40. Crossed Sticks Lv 1 1 pt. 37,285

Comments