Placeholder image of a protein
Icon representing a puzzle

2738: Electron Density Reconstruction 161

Closed since 16 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 03, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2R5Z

Sequence
ACTCTAAGATTAATCGGCTG GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI TCAGCCGATTAATCTTAGAG

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 18,862
  2. Avatar for Team China 12. Team China 1 pt. 18,549
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 18,231
  1. Avatar for hada 21. hada Lv 1 16 pts. 33,760
  2. Avatar for nicobul 22. nicobul Lv 1 15 pts. 33,646
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 13 pts. 33,595
  4. Avatar for Idiotboy 24. Idiotboy Lv 1 12 pts. 33,431
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 10 pts. 33,129
  6. Avatar for g_b 26. g_b Lv 1 9 pts. 33,115
  7. Avatar for RandomProteinFolder 27. RandomProteinFolder Lv 1 8 pts. 32,790
  8. Avatar for Kevonni 28. Kevonni Lv 1 7 pts. 32,695
  9. Avatar for SlimyCy 29. SlimyCy Lv 1 6 pts. 32,415
  10. Avatar for dcrwheeler 30. dcrwheeler Lv 1 6 pts. 31,133

Comments