Placeholder image of a protein
Icon representing a puzzle

2738: Electron Density Reconstruction 161

Closed since 16 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 03, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2R5Z

Sequence
ACTCTAAGATTAATCGGCTG GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI TCAGCCGATTAATCTTAGAG

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 18,862
  2. Avatar for Team China 12. Team China 1 pt. 18,549
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 18,231
  1. Avatar for pfirth 41. pfirth Lv 1 1 pt. 23,425
  2. Avatar for Stas Gunko 42. Stas Gunko Lv 1 1 pt. 23,033
  3. Avatar for Wanderer09 43. Wanderer09 Lv 1 1 pt. 22,519
  4. Avatar for Painture 44. Painture Lv 1 1 pt. 21,743
  5. Avatar for CipherZ 45. CipherZ Lv 1 1 pt. 21,368
  6. Avatar for RWoodcock 46. RWoodcock Lv 1 1 pt. 20,607
  7. Avatar for zxspectrum 47. zxspectrum Lv 1 1 pt. 20,600
  8. Avatar for Guiguitare 48. Guiguitare Lv 1 1 pt. 19,719
  9. Avatar for rosie4loop 49. rosie4loop Lv 1 1 pt. 19,487
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 19,283

Comments