Placeholder image of a protein
Icon representing a puzzle

2738: Electron Density Reconstruction 161

Closed since 16 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 03, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2R5Z

Sequence
ACTCTAAGATTAATCGGCTG GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI TCAGCCGATTAATCTTAGAG

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 18,862
  2. Avatar for Team China 12. Team China 1 pt. 18,549
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 18,231
  1. Avatar for carxo 51. carxo Lv 1 1 pt. 19,090
  2. Avatar for Fasodankfds 52. Fasodankfds Lv 1 1 pt. 19,084
  3. Avatar for RichGuilmain 53. RichGuilmain Lv 1 1 pt. 18,946
  4. Avatar for Savas 54. Savas Lv 1 1 pt. 18,862
  5. Avatar for zo3xiaJonWeinberg 55. zo3xiaJonWeinberg Lv 1 1 pt. 18,549
  6. Avatar for Larini 56. Larini Lv 1 1 pt. 18,497
  7. Avatar for zbp 57. zbp Lv 1 1 pt. 18,419
  8. Avatar for ucad 58. ucad Lv 1 1 pt. 18,311
  9. Avatar for ProfVince 59. ProfVince Lv 1 1 pt. 18,281
  10. Avatar for ShadowTactics 60. ShadowTactics Lv 1 1 pt. 18,231

Comments