Placeholder image of a protein
Icon representing a puzzle

2738: Electron Density Reconstruction 161

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 03, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2R5Z

Sequence
ACTCTAAGATTAATCGGCTG GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI TCAGCCGATTAATCTTAGAG

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 18,862
  2. Avatar for Team China 12. Team China 1 pt. 18,549
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 18,231

  1. Avatar for jamiexq 61. jamiexq Lv 1 1 pt. 17,826
  2. Avatar for Girofalco 62. Girofalco Lv 1 1 pt. 16,990
  3. Avatar for lickington 63. lickington Lv 1 1 pt. 15,962
  4. Avatar for CassowaryDyke 64. CassowaryDyke Lv 1 1 pt. 15,620
  5. Avatar for toshiue 65. toshiue Lv 1 1 pt. 3,602
  6. Avatar for Hellcat6 66. Hellcat6 Lv 1 1 pt. 3,602

Comments