Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since about 5 hours ago

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,750
  1. Avatar for Elfi 11. Elfi Lv 1 35 pts. 9,958
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 31 pts. 9,910
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 27 pts. 9,904
  4. Avatar for Dr. Goochie 14. Dr. Goochie Lv 1 24 pts. 9,887
  5. Avatar for grogar7 15. grogar7 Lv 1 21 pts. 9,886
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 19 pts. 9,886
  7. Avatar for g_b 17. g_b Lv 1 16 pts. 9,872
  8. Avatar for Tehnologik1 18. Tehnologik1 Lv 1 14 pts. 9,843
  9. Avatar for bravosk8erboy 19. bravosk8erboy Lv 1 12 pts. 9,833
  10. Avatar for Galaxie 20. Galaxie Lv 1 11 pts. 9,717

Comments