Foldit Puzzles

2328: Revisiting Puzzle 87: Zinc Binding Protein

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

2327: KLHDC2 the Next Level: Round 7

Foldit players have discovered a small molecule fragment which binds well to KLHDC2. Take this starting fragment and expand upon it.

2326: Electron Density Reconstruction 48

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

2324: Revisiting Puzzle 86: Nematode

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

2325: KLHDC2 the Next Level: Round 6

Foldit players have discovered a small molecule fragment which binds well to KLHDC2. Take this starting fragment and expand upon it.

2323: Electron Density Reconstruction 47

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has three copies in it, but they have rather different amounts of amino acids that are actually visible.

2320: Revisiting Puzzle 85: Cell Adhesion Protein

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

2322: KLHDC2 the Next Level: Round 5

Foldit players have discovered a small molecule fragment which binds well to KLHDC2. Take this starting fragment and expand upon it.

2321: Electron Density Reconstruction 46

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

2319: KLHDC2 the Next Level: Round 4

Foldit players have discovered a small molecule fragment which binds well to KLHDC2. Take this starting fragment and expand upon it.