Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for bwkittitas 141. bwkittitas Lv 1 1 pt. 7,666
  2. Avatar for rinze 142. rinze Lv 1 1 pt. 7,663
  3. Avatar for dahast.de 143. dahast.de Lv 1 1 pt. 7,653
  4. Avatar for foldit@bechan 144. foldit@bechan Lv 1 1 pt. 7,651
  5. Avatar for t012 145. t012 Lv 1 1 pt. 7,636
  6. Avatar for lim8 146. lim8 Lv 1 1 pt. 7,634
  7. Avatar for tela 147. tela Lv 1 1 pt. 7,634
  8. Avatar for apostol3 148. apostol3 Lv 1 1 pt. 7,625
  9. Avatar for NotJim99 149. NotJim99 Lv 1 1 pt. 7,610
  10. Avatar for dmiller13 150. dmiller13 Lv 1 1 pt. 7,577

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.