Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups


  1. Avatar for Contenders 100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471

  1. Avatar for Vredeman 11. Vredeman Lv 1 80 pts. 8,668
  2. Avatar for nemo7731 12. nemo7731 Lv 1 79 pts. 8,662
  3. Avatar for Susume 13. Susume Lv 1 77 pts. 8,655
  4. Avatar for KarenCH 14. KarenCH Lv 1 75 pts. 8,653
  5. Avatar for gmn 15. gmn Lv 1 73 pts. 8,637
  6. Avatar for pauldunn 16. pauldunn Lv 1 72 pts. 8,636
  7. Avatar for Timo van der Laan 17. Timo van der Laan Lv 1 70 pts. 8,623
  8. Avatar for LociOiling 18. LociOiling Lv 1 68 pts. 8,611
  9. Avatar for pmdpmd 19. pmdpmd Lv 1 67 pts. 8,601
  10. Avatar for goastano 20. goastano Lv 1 65 pts. 8,601

Comments


bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.