Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471
  1. Avatar for smilingone 41. smilingone Lv 1 39 pts. 8,492
  2. Avatar for Sissue 42. Sissue Lv 1 38 pts. 8,492
  3. Avatar for sheerbliss 43. sheerbliss Lv 1 37 pts. 8,484
  4. Avatar for hansvandenhof 44. hansvandenhof Lv 1 36 pts. 8,481
  5. Avatar for Deleted player 45. Deleted player 35 pts. 8,477
  6. Avatar for molleke 46. molleke Lv 1 34 pts. 8,471
  7. Avatar for reefyrob 47. reefyrob Lv 1 33 pts. 8,467
  8. Avatar for O Seki To 48. O Seki To Lv 1 32 pts. 8,445
  9. Avatar for Skippysk8s 49. Skippysk8s Lv 1 31 pts. 8,433
  10. Avatar for christioanchauvin 50. christioanchauvin Lv 1 30 pts. 8,431

Comments

bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.