Placeholder image of a protein
Icon representing a puzzle

1126: De-novo Freestyle 55

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
August 14, 2015
Expires
Max points
100
Description

Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR

Top groups


  1. Avatar for Contenders 100 pts. 8,864
  2. Avatar for Go Science 2. Go Science 77 pts. 8,816
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 8,811
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 8,725
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 8,694
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 8,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 8,601
  8. Avatar for Deleted group 8. Deleted group pts. 8,497
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 8,485
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 8,471

  1. Avatar for alcor29 31. alcor29 Lv 1 50 pts. 8,538
  2. Avatar for Deleted player 32. Deleted player pts. 8,537
  3. Avatar for Museka 33. Museka Lv 1 47 pts. 8,537
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 46 pts. 8,535
  5. Avatar for lilovip 35. lilovip Lv 1 45 pts. 8,520
  6. Avatar for Bletchley Park 36. Bletchley Park Lv 1 44 pts. 8,518
  7. Avatar for Blipperman 37. Blipperman Lv 1 43 pts. 8,517
  8. Avatar for WarpSpeed 38. WarpSpeed Lv 1 42 pts. 8,516
  9. Avatar for TomTaylor 39. TomTaylor Lv 1 41 pts. 8,495
  10. Avatar for g_b 40. g_b Lv 1 40 pts. 8,492

Comments


bkoep Staff Lv 1

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.