Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for KarenCH 11. KarenCH Lv 1 84 pts. 9,268
  2. Avatar for gmn 12. gmn Lv 1 82 pts. 9,259
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 81 pts. 9,258
  4. Avatar for actiasluna 14. actiasluna Lv 1 79 pts. 9,252
  5. Avatar for Deleted player 15. Deleted player pts. 9,246
  6. Avatar for Vredeman 16. Vredeman Lv 1 76 pts. 9,242
  7. Avatar for g_b 17. g_b Lv 1 75 pts. 9,231
  8. Avatar for retiredmichael 18. retiredmichael Lv 1 73 pts. 9,226
  9. Avatar for Galaxie 19. Galaxie Lv 1 72 pts. 9,218
  10. Avatar for johnmitch 20. johnmitch Lv 1 70 pts. 9,217

Comments