Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for Mike Cassidy 261. Mike Cassidy Lv 1 1 pt. 6,525
  2. Avatar for Aurox15 262. Aurox15 Lv 1 1 pt. 6,147
  3. Avatar for CrowdSem15 263. CrowdSem15 Lv 1 1 pt. 6,133
  4. Avatar for wozzarelli 264. wozzarelli Lv 1 1 pt. 5,964
  5. Avatar for rozrabiaka133 265. rozrabiaka133 Lv 1 1 pt. 5,604
  6. Avatar for bbbrandon 266. bbbrandon Lv 1 1 pt. 2,437
  7. Avatar for jackie123 267. jackie123 Lv 1 1 pt. 2,437
  8. Avatar for Pyotr 268. Pyotr Lv 1 1 pt. 2,437
  9. Avatar for Leon C 269. Leon C Lv 1 1 pt. 2,437
  10. Avatar for Simek 270. Simek Lv 1 1 pt. 2,437

Comments