Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437
  1. Avatar for deLaCeiba 31. deLaCeiba Lv 1 57 pts. 9,120
  2. Avatar for shettler 32. shettler Lv 1 55 pts. 9,116
  3. Avatar for cbwest 33. cbwest Lv 1 54 pts. 9,110
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 53 pts. 9,108
  5. Avatar for eusair 35. eusair Lv 1 52 pts. 9,082
  6. Avatar for manu8170 36. manu8170 Lv 1 51 pts. 9,080
  7. Avatar for gurch 37. gurch Lv 1 50 pts. 9,074
  8. Avatar for egran48 38. egran48 Lv 1 49 pts. 9,071
  9. Avatar for TomTaylor 39. TomTaylor Lv 1 48 pts. 9,069
  10. Avatar for Satina 40. Satina Lv 1 47 pts. 9,065

Comments