Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437

  1. Avatar for isaksson 71. isaksson Lv 1 24 pts. 8,873
  2. Avatar for Mohambone 72. Mohambone Lv 1 23 pts. 8,872
  3. Avatar for tallguy-13088 73. tallguy-13088 Lv 1 22 pts. 8,859
  4. Avatar for nemo7731 74. nemo7731 Lv 1 22 pts. 8,839
  5. Avatar for dettingen 75. dettingen Lv 1 21 pts. 8,839
  6. Avatar for harvardman 76. harvardman Lv 1 21 pts. 8,823
  7. Avatar for goastano 77. goastano Lv 1 20 pts. 8,820
  8. Avatar for pfirth 78. pfirth Lv 1 20 pts. 8,817
  9. Avatar for guineapig 79. guineapig Lv 1 19 pts. 8,810
  10. Avatar for marie.p 80. marie.p Lv 1 19 pts. 8,810

Comments