Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team Germany 21. Team Germany 1 pt. 7,294
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,249
  3. Avatar for freefolder 23. freefolder 1 pt. 7,080
  4. Avatar for OU CHEM4923 24. OU CHEM4923 1 pt. 2,437
  5. Avatar for incognito group 25. incognito group 1 pt. 2,437

  1. Avatar for Mydogisa Toelicker 81. Mydogisa Toelicker Lv 1 18 pts. 8,808
  2. Avatar for hansvandenhof 82. hansvandenhof Lv 1 18 pts. 8,803
  3. Avatar for pfeiffelfloyd 83. pfeiffelfloyd Lv 1 18 pts. 8,783
  4. Avatar for Ernst Zundel 84. Ernst Zundel Lv 1 17 pts. 8,770
  5. Avatar for TJOK fan 85. TJOK fan Lv 1 17 pts. 8,763
  6. Avatar for Deleted player 86. Deleted player pts. 8,755
  7. Avatar for fryguy 87. fryguy Lv 1 16 pts. 8,749
  8. Avatar for Festering Wounds 88. Festering Wounds Lv 1 15 pts. 8,742
  9. Avatar for vuvuvu 89. vuvuvu Lv 1 15 pts. 8,739
  10. Avatar for dbuske 90. dbuske Lv 1 15 pts. 8,736

Comments