Placeholder image of a protein
Icon representing a puzzle

1151: Revisiting Puzzle 96: Collagen

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 21, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,385
  2. Avatar for Go Science 2. Go Science 81 pts. 9,380
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,343
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,341
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,300
  6. Avatar for Void Crushers 6. Void Crushers 32 pts. 9,258
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,242
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,209
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 9,120
  10. Avatar for Deleted group 10. Deleted group pts. 9,028
  1. Avatar for Mydogisa Toelicker 81. Mydogisa Toelicker Lv 1 18 pts. 8,808
  2. Avatar for hansvandenhof 82. hansvandenhof Lv 1 18 pts. 8,803
  3. Avatar for pfeiffelfloyd 83. pfeiffelfloyd Lv 1 18 pts. 8,783
  4. Avatar for Ernst Zundel 84. Ernst Zundel Lv 1 17 pts. 8,770
  5. Avatar for TJOK fan 85. TJOK fan Lv 1 17 pts. 8,763
  6. Avatar for Deleted player 86. Deleted player pts. 8,755
  7. Avatar for fryguy 87. fryguy Lv 1 16 pts. 8,749
  8. Avatar for Festering Wounds 88. Festering Wounds Lv 1 15 pts. 8,742
  9. Avatar for vuvuvu 89. vuvuvu Lv 1 15 pts. 8,739
  10. Avatar for dbuske 90. dbuske Lv 1 15 pts. 8,736

Comments