Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for drumpeter18yrs9yrs 51. drumpeter18yrs9yrs Lv 1 38 pts. 9,039
  2. Avatar for smilingone 52. smilingone Lv 1 37 pts. 9,020
  3. Avatar for Mike Cassidy 53. Mike Cassidy Lv 1 37 pts. 9,009
  4. Avatar for isaksson 54. isaksson Lv 1 36 pts. 9,001
  5. Avatar for g_b 55. g_b Lv 1 35 pts. 8,998
  6. Avatar for hpaege 56. hpaege Lv 1 34 pts. 8,994
  7. Avatar for egran48 57. egran48 Lv 1 34 pts. 8,986
  8. Avatar for Anfinsen_slept_here 58. Anfinsen_slept_here Lv 1 33 pts. 8,981
  9. Avatar for guineapig 59. guineapig Lv 1 32 pts. 8,969
  10. Avatar for Vredeman 60. Vredeman Lv 1 31 pts. 8,955

Comments