Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850

  1. Avatar for hansvandenhof 21. hansvandenhof Lv 1 70 pts. 9,226
  2. Avatar for WarpSpeed 22. WarpSpeed Lv 1 68 pts. 9,216
  3. Avatar for gitwut 23. gitwut Lv 1 67 pts. 9,205
  4. Avatar for shettler 24. shettler Lv 1 66 pts. 9,202
  5. Avatar for mimi 25. mimi Lv 1 65 pts. 9,193
  6. Avatar for strong_base 26. strong_base Lv 1 63 pts. 9,189
  7. Avatar for Blipperman 27. Blipperman Lv 1 62 pts. 9,188
  8. Avatar for johnmitch 28. johnmitch Lv 1 61 pts. 9,186
  9. Avatar for Madde 29. Madde Lv 1 60 pts. 9,181
  10. Avatar for lynnai 30. lynnai Lv 1 59 pts. 9,180

Comments