Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,800
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,725
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,548
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,286
  5. Avatar for Deleted group 15. Deleted group pts. 8,225
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,210
  7. Avatar for Deleted group 17. Deleted group pts. 7,796
  8. Avatar for Deleted group 18. Deleted group pts. 6,855
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,196

  1. Avatar for momadoc 141. momadoc Lv 1 3 pts. 8,354
  2. Avatar for which.chick 142. which.chick Lv 1 3 pts. 8,347
  3. Avatar for isantheautumn 143. isantheautumn Lv 1 2 pts. 8,344
  4. Avatar for navn 144. navn Lv 1 2 pts. 8,335
  5. Avatar for Gabs_the_lil_protein 145. Gabs_the_lil_protein Lv 1 2 pts. 8,334
  6. Avatar for hans930222 146. hans930222 Lv 1 2 pts. 8,325
  7. Avatar for dbuske 147. dbuske Lv 1 2 pts. 8,308
  8. Avatar for rws 148. rws Lv 1 2 pts. 8,286
  9. Avatar for bwkittitas 149. bwkittitas Lv 1 2 pts. 8,277
  10. Avatar for Maru67 150. Maru67 Lv 1 2 pts. 8,242

Comments