Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903
  1. Avatar for momadoc 141. momadoc Lv 1 3 pts. 8,354
  2. Avatar for which.chick 142. which.chick Lv 1 3 pts. 8,347
  3. Avatar for isantheautumn 143. isantheautumn Lv 1 2 pts. 8,344
  4. Avatar for navn 144. navn Lv 1 2 pts. 8,335
  5. Avatar for Gabs_the_lil_protein 145. Gabs_the_lil_protein Lv 1 2 pts. 8,334
  6. Avatar for hans930222 146. hans930222 Lv 1 2 pts. 8,325
  7. Avatar for dbuske 147. dbuske Lv 1 2 pts. 8,308
  8. Avatar for rws 148. rws Lv 1 2 pts. 8,286
  9. Avatar for bwkittitas 149. bwkittitas Lv 1 2 pts. 8,277
  10. Avatar for Maru67 150. Maru67 Lv 1 2 pts. 8,242

Comments