Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,800
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,725
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,548
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,286
  5. Avatar for Deleted group 15. Deleted group pts. 8,225
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,210
  7. Avatar for Deleted group 17. Deleted group pts. 7,796
  8. Avatar for Deleted group 18. Deleted group pts. 6,855
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,196

  1. Avatar for Truncheon Luncheon 161. Truncheon Luncheon Lv 1 1 pt. 8,201
  2. Avatar for PrettyPony2001 162. PrettyPony2001 Lv 1 1 pt. 8,196
  3. Avatar for TJOK fan 163. TJOK fan Lv 1 1 pt. 8,195
  4. Avatar for Ernst Zundel 164. Ernst Zundel Lv 1 1 pt. 8,195
  5. Avatar for NameChangeNeeded01 165. NameChangeNeeded01 Lv 1 1 pt. 8,193
  6. Avatar for Pro Lapser 166. Pro Lapser Lv 1 1 pt. 8,193
  7. Avatar for Festering Wounds 167. Festering Wounds Lv 1 1 pt. 8,193
  8. Avatar for Superphosphate 168. Superphosphate Lv 1 1 pt. 8,179
  9. Avatar for Incongruous 169. Incongruous Lv 1 1 pt. 8,178
  10. Avatar for rezaefar 170. rezaefar Lv 1 1 pt. 8,163

Comments