Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903

  1. Avatar for Truncheon Luncheon 161. Truncheon Luncheon Lv 1 1 pt. 8,201
  2. Avatar for PrettyPony2001 162. PrettyPony2001 Lv 1 1 pt. 8,196
  3. Avatar for TJOK fan 163. TJOK fan Lv 1 1 pt. 8,195
  4. Avatar for Ernst Zundel 164. Ernst Zundel Lv 1 1 pt. 8,195
  5. Avatar for NameChangeNeeded01 165. NameChangeNeeded01 Lv 1 1 pt. 8,193
  6. Avatar for Pro Lapser 166. Pro Lapser Lv 1 1 pt. 8,193
  7. Avatar for Festering Wounds 167. Festering Wounds Lv 1 1 pt. 8,193
  8. Avatar for Superphosphate 168. Superphosphate Lv 1 1 pt. 8,179
  9. Avatar for Incongruous 169. Incongruous Lv 1 1 pt. 8,178
  10. Avatar for rezaefar 170. rezaefar Lv 1 1 pt. 8,163

Comments