Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 8,800
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 2 pts. 8,725
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,548
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,286
  5. Avatar for Deleted group 15. Deleted group pts. 8,225
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,210
  7. Avatar for Deleted group 17. Deleted group pts. 7,796
  8. Avatar for Deleted group 18. Deleted group pts. 6,855
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,196

  1. Avatar for fryguy 61. fryguy Lv 1 27 pts. 8,908
  2. Avatar for phi16 62. phi16 Lv 1 27 pts. 8,907
  3. Avatar for Anfinsen_slept_here 63. Anfinsen_slept_here Lv 1 26 pts. 8,903
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 25 pts. 8,901
  5. Avatar for Simek 65. Simek Lv 1 25 pts. 8,900
  6. Avatar for stomjoh 66. stomjoh Lv 1 24 pts. 8,893
  7. Avatar for christioanchauvin 67. christioanchauvin Lv 1 24 pts. 8,881
  8. Avatar for egran48 68. egran48 Lv 1 23 pts. 8,877
  9. Avatar for Norrjane 69. Norrjane Lv 1 22 pts. 8,872
  10. Avatar for pvc78 70. pvc78 Lv 1 22 pts. 8,850

Comments