Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903
  1. Avatar for mitarcher 111. mitarcher Lv 1 7 pts. 8,611
  2. Avatar for pfirth 112. pfirth Lv 1 7 pts. 8,604
  3. Avatar for Jim Fraser 113. Jim Fraser Lv 1 6 pts. 8,603
  4. Avatar for caglar 114. caglar Lv 1 6 pts. 8,601
  5. Avatar for heather-1 115. heather-1 Lv 1 6 pts. 8,592
  6. Avatar for georgefield 116. georgefield Lv 1 6 pts. 8,589
  7. Avatar for arginia 117. arginia Lv 1 6 pts. 8,556
  8. Avatar for t012 118. t012 Lv 1 6 pts. 8,551
  9. Avatar for senor pit 119. senor pit Lv 1 5 pts. 8,548
  10. Avatar for kitek314_pl 120. kitek314_pl Lv 1 5 pts. 8,548

Comments