Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903

  1. Avatar for DaMaxl 121. DaMaxl Lv 1 5 pts. 8,541
  2. Avatar for Vinara 122. Vinara Lv 1 5 pts. 8,503
  3. Avatar for Merf 123. Merf Lv 1 5 pts. 8,499
  4. Avatar for smholst 124. smholst Lv 1 5 pts. 8,497
  5. Avatar for franse 125. franse Lv 1 4 pts. 8,464
  6. Avatar for Deleted player 126. Deleted player pts. 8,458
  7. Avatar for Iron pet 127. Iron pet Lv 1 4 pts. 8,455
  8. Avatar for lightnir 128. lightnir Lv 1 4 pts. 8,447
  9. Avatar for foldit04 129. foldit04 Lv 1 4 pts. 8,443
  10. Avatar for johngran 130. johngran Lv 1 4 pts. 8,439

Comments