Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for Vinara 91. Vinara Lv 1 6 pts. 8,735
  2. Avatar for pfirth 92. pfirth Lv 1 6 pts. 8,722
  3. Avatar for ViJay7019 93. ViJay7019 Lv 1 5 pts. 8,720
  4. Avatar for Truncheon Luncheon 94. Truncheon Luncheon Lv 1 5 pts. 8,718
  5. Avatar for tallguy-13088 95. tallguy-13088 Lv 1 5 pts. 8,711
  6. Avatar for NameChangeNeeded01 96. NameChangeNeeded01 Lv 1 5 pts. 8,709
  7. Avatar for rg_sar 97. rg_sar Lv 1 5 pts. 8,700
  8. Avatar for PrettyPony2001 98. PrettyPony2001 Lv 1 4 pts. 8,667
  9. Avatar for Bautho 99. Bautho Lv 1 4 pts. 8,660
  10. Avatar for caglar 100. caglar Lv 1 4 pts. 8,659

Comments