Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169
  1. Avatar for Vinara 91. Vinara Lv 1 6 pts. 8,735
  2. Avatar for pfirth 92. pfirth Lv 1 6 pts. 8,722
  3. Avatar for ViJay7019 93. ViJay7019 Lv 1 5 pts. 8,720
  4. Avatar for Truncheon Luncheon 94. Truncheon Luncheon Lv 1 5 pts. 8,718
  5. Avatar for tallguy-13088 95. tallguy-13088 Lv 1 5 pts. 8,711
  6. Avatar for NameChangeNeeded01 96. NameChangeNeeded01 Lv 1 5 pts. 8,709
  7. Avatar for rg_sar 97. rg_sar Lv 1 5 pts. 8,700
  8. Avatar for PrettyPony2001 98. PrettyPony2001 Lv 1 4 pts. 8,667
  9. Avatar for Bautho 99. Bautho Lv 1 4 pts. 8,660
  10. Avatar for caglar 100. caglar Lv 1 4 pts. 8,659

Comments