Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for Iron pet 101. Iron pet Lv 1 4 pts. 8,649
  2. Avatar for Mr_Jolty 102. Mr_Jolty Lv 1 4 pts. 8,641
  3. Avatar for YGK 103. YGK Lv 1 4 pts. 8,630
  4. Avatar for JUMELLE54 104. JUMELLE54 Lv 1 3 pts. 8,628
  5. Avatar for Merf 105. Merf Lv 1 3 pts. 8,620
  6. Avatar for Festering Wounds 106. Festering Wounds Lv 1 3 pts. 8,598
  7. Avatar for kitek314_pl 107. kitek314_pl Lv 1 3 pts. 8,582
  8. Avatar for karost 108. karost Lv 1 3 pts. 8,576
  9. Avatar for Mohambone 109. Mohambone Lv 1 3 pts. 8,551
  10. Avatar for Superphosphate 110. Superphosphate Lv 1 3 pts. 8,544

Comments