Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169

  1. Avatar for Iron pet 101. Iron pet Lv 1 4 pts. 8,649
  2. Avatar for Mr_Jolty 102. Mr_Jolty Lv 1 4 pts. 8,641
  3. Avatar for YGK 103. YGK Lv 1 4 pts. 8,630
  4. Avatar for JUMELLE54 104. JUMELLE54 Lv 1 3 pts. 8,628
  5. Avatar for Merf 105. Merf Lv 1 3 pts. 8,620
  6. Avatar for Festering Wounds 106. Festering Wounds Lv 1 3 pts. 8,598
  7. Avatar for kitek314_pl 107. kitek314_pl Lv 1 3 pts. 8,582
  8. Avatar for karost 108. karost Lv 1 3 pts. 8,576
  9. Avatar for Mohambone 109. Mohambone Lv 1 3 pts. 8,551
  10. Avatar for Superphosphate 110. Superphosphate Lv 1 3 pts. 8,544

Comments