Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for bhodg1 111. bhodg1 Lv 1 3 pts. 8,523
  2. Avatar for Psych0Active 112. Psych0Active Lv 1 2 pts. 8,519
  3. Avatar for Ernst Zundel 113. Ernst Zundel Lv 1 2 pts. 8,506
  4. Avatar for arginia 114. arginia Lv 1 2 pts. 8,497
  5. Avatar for lacie 115. lacie Lv 1 2 pts. 8,495
  6. Avatar for NotJim99 116. NotJim99 Lv 1 2 pts. 8,461
  7. Avatar for IHGreenman 117. IHGreenman Lv 1 2 pts. 8,448
  8. Avatar for SKSbell 118. SKSbell Lv 1 2 pts. 8,389
  9. Avatar for martinf 119. martinf Lv 1 2 pts. 8,374
  10. Avatar for cbwest 120. cbwest Lv 1 2 pts. 8,356

Comments