Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169

  1. Avatar for bhodg1 111. bhodg1 Lv 1 3 pts. 8,523
  2. Avatar for Psych0Active 112. Psych0Active Lv 1 2 pts. 8,519
  3. Avatar for Ernst Zundel 113. Ernst Zundel Lv 1 2 pts. 8,506
  4. Avatar for arginia 114. arginia Lv 1 2 pts. 8,497
  5. Avatar for lacie 115. lacie Lv 1 2 pts. 8,495
  6. Avatar for NotJim99 116. NotJim99 Lv 1 2 pts. 8,461
  7. Avatar for IHGreenman 117. IHGreenman Lv 1 2 pts. 8,448
  8. Avatar for SKSbell 118. SKSbell Lv 1 2 pts. 8,389
  9. Avatar for martinf 119. martinf Lv 1 2 pts. 8,374
  10. Avatar for cbwest 120. cbwest Lv 1 2 pts. 8,356

Comments