Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for cherry39 151. cherry39 Lv 1 1 pt. 7,822
  2. Avatar for Poovent 152. Poovent Lv 1 1 pt. 7,740
  3. Avatar for DrTree 153. DrTree Lv 1 1 pt. 7,712
  4. Avatar for cnhrcolemam 154. cnhrcolemam Lv 1 1 pt. 7,690
  5. Avatar for Jim Fraser 155. Jim Fraser Lv 1 1 pt. 7,667
  6. Avatar for Radeodem8 156. Radeodem8 Lv 1 1 pt. 7,591
  7. Avatar for jbmkfm125 157. jbmkfm125 Lv 1 1 pt. 7,572
  8. Avatar for Albatross795 158. Albatross795 Lv 1 1 pt. 7,555
  9. Avatar for isantheautumn 159. isantheautumn Lv 1 1 pt. 7,514
  10. Avatar for Vredeman 160. Vredeman Lv 1 1 pt. 7,440

Comments