Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for Bushman 71. Bushman Lv 1 13 pts. 8,904
  2. Avatar for bamh 72. bamh Lv 1 12 pts. 8,896
  3. Avatar for hansvandenhof 73. hansvandenhof Lv 1 12 pts. 8,892
  4. Avatar for fiendish_ghoul 74. fiendish_ghoul Lv 1 11 pts. 8,885
  5. Avatar for stomjoh 75. stomjoh Lv 1 11 pts. 8,874
  6. Avatar for Colostomy EXPLOSION. 76. Colostomy EXPLOSION. Lv 1 11 pts. 8,864
  7. Avatar for decbin 77. decbin Lv 1 10 pts. 8,849
  8. Avatar for pvc78 78. pvc78 Lv 1 10 pts. 8,842
  9. Avatar for ecali 79. ecali Lv 1 9 pts. 8,811
  10. Avatar for johngran 80. johngran Lv 1 9 pts. 8,802

Comments