Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169
  1. Avatar for Bushman 71. Bushman Lv 1 13 pts. 8,904
  2. Avatar for bamh 72. bamh Lv 1 12 pts. 8,896
  3. Avatar for hansvandenhof 73. hansvandenhof Lv 1 12 pts. 8,892
  4. Avatar for fiendish_ghoul 74. fiendish_ghoul Lv 1 11 pts. 8,885
  5. Avatar for stomjoh 75. stomjoh Lv 1 11 pts. 8,874
  6. Avatar for Colostomy EXPLOSION. 76. Colostomy EXPLOSION. Lv 1 11 pts. 8,864
  7. Avatar for decbin 77. decbin Lv 1 10 pts. 8,849
  8. Avatar for pvc78 78. pvc78 Lv 1 10 pts. 8,842
  9. Avatar for ecali 79. ecali Lv 1 9 pts. 8,811
  10. Avatar for johngran 80. johngran Lv 1 9 pts. 8,802

Comments