Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for WonkyDonkey 81. WonkyDonkey Lv 1 9 pts. 8,800
  2. Avatar for Deleted player 82. Deleted player pts. 8,800
  3. Avatar for Mydogisa Toelicker 83. Mydogisa Toelicker Lv 1 8 pts. 8,797
  4. Avatar for t012 84. t012 Lv 1 8 pts. 8,773
  5. Avatar for Pro Lapser 85. Pro Lapser Lv 1 8 pts. 8,772
  6. Avatar for senor pit 86. senor pit Lv 1 7 pts. 8,769
  7. Avatar for bendbob 87. bendbob Lv 1 7 pts. 8,767
  8. Avatar for YeshuaLives 88. YeshuaLives Lv 1 7 pts. 8,756
  9. Avatar for heather-1 89. heather-1 Lv 1 6 pts. 8,755
  10. Avatar for Soggy Doglog 90. Soggy Doglog Lv 1 6 pts. 8,745

Comments