Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,427
  2. Avatar for Go Science 2. Go Science 73 pts. 9,387
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,376
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,368
  5. Avatar for Contenders 5. Contenders 24 pts. 9,366
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,362
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 10 pts. 9,321
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,176
  9. Avatar for Deleted group 9. Deleted group pts. 9,172
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,169
  1. Avatar for WonkyDonkey 81. WonkyDonkey Lv 1 9 pts. 8,800
  2. Avatar for Deleted player 82. Deleted player pts. 8,800
  3. Avatar for Mydogisa Toelicker 83. Mydogisa Toelicker Lv 1 8 pts. 8,797
  4. Avatar for t012 84. t012 Lv 1 8 pts. 8,773
  5. Avatar for Pro Lapser 85. Pro Lapser Lv 1 8 pts. 8,772
  6. Avatar for senor pit 86. senor pit Lv 1 7 pts. 8,769
  7. Avatar for bendbob 87. bendbob Lv 1 7 pts. 8,767
  8. Avatar for YeshuaLives 88. YeshuaLives Lv 1 7 pts. 8,756
  9. Avatar for heather-1 89. heather-1 Lv 1 6 pts. 8,755
  10. Avatar for Soggy Doglog 90. Soggy Doglog Lv 1 6 pts. 8,745

Comments