Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326
  1. Avatar for Iron pet 131. Iron pet Lv 1 2 pts. 8,295
  2. Avatar for bwkittitas 132. bwkittitas Lv 1 2 pts. 8,272
  3. Avatar for asperger1993 133. asperger1993 Lv 1 2 pts. 8,271
  4. Avatar for mitarcher 134. mitarcher Lv 1 2 pts. 8,255
  5. Avatar for fpc 135. fpc Lv 1 2 pts. 8,249
  6. Avatar for dbuske 136. dbuske Lv 1 2 pts. 8,237
  7. Avatar for Maru67 137. Maru67 Lv 1 2 pts. 8,235
  8. Avatar for parsnip 138. parsnip Lv 1 1 pt. 8,232
  9. Avatar for firejuggler 139. firejuggler Lv 1 1 pt. 8,214
  10. Avatar for Sydefecks 140. Sydefecks Lv 1 1 pt. 8,192

Comments